SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226354865|ref|YP_002784605.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226354865|ref|YP_002784605.1|
Domain Number 1 Region: 31-80,205-372
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.65e-46
Family Bacterial dinuclear zinc exopeptidases 0.012
Further Details:      
 
Domain Number 2 Region: 96-168
Classification Level Classification E-value
Superfamily PA domain 0.00000000000000129
Family PA domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226354865|ref|YP_002784605.1|
Sequence length 398
Comment peptidase family M28 protein [Deinococcus deserti VCD115]
Sequence
MFGFTACFAEGMQTWKLGALTGALMLVSSALANIEEDLSTVLKFGPRVAGSEANEKARAY
FEAQFQALGYMTRRDVFTYPRFDDLGSDVRVGTRTLAGRALEGSTGGTVSARVVRVPGVG
TPENFRAVNVRGQVAVVQRGQIPFLEKARNALAAGAAGLIVVNNEDKELQGRLGERTELP
ALAVSSSTGAGLRNDERVTLNVRVRDGEVRGVNVVAFKSGVTRPEILFGGHMDSVLRSPG
ANDNLSGTAAVVEIARRTATTPMAQRSYFVLFDGEEDGLRGSRAFVKENPLLVQGLKAMF
NFDMVGVNVTPLNVSGESRLVDIARQAAQIAGSSPDRGGSDQAPFAQAGIPTLFFHRGLD
TNYHQPTDTLADPALIRATVDAALKTADAALLAVPAGR
Download sequence
Identical sequences WP_012691974.1.1337 gi|226354865|ref|YP_002784605.1| 546414.Deide_00540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]