SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226355467|ref|YP_002785207.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226355467|ref|YP_002785207.1|
Domain Number 1 Region: 4-54
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 4.15e-19
Family Ribosomal protein L33p 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226355467|ref|YP_002785207.1|
Sequence length 55
Comment 50S ribosomal protein L33 [Deinococcus deserti VCD115]
Sequence
MAKDGPRIIVKMESTAGTGFYYTTTKNRRNTQAKMELRKYDPVAKKHVVFKEKKV
Download sequence
Identical sequences A0A016QNI5 A0A1W1VKP2 A0A2I9CZX8 C1D0S9
WP_012692576.1.1337 WP_012692576.1.31558 WP_012692576.1.45726 WP_012692576.1.80842 gi|226355467|ref|YP_002785207.1| 546414.Deide_06110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]