SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226355574|ref|YP_002785314.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226355574|ref|YP_002785314.1|
Domain Number 1 Region: 333-561
Classification Level Classification E-value
Superfamily PHP domain-like 1.16e-40
Family PHP domain 0.0036
Further Details:      
 
Domain Number 2 Region: 5-82
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.00000000379
Family DNA polymerase beta, N-terminal domain-like 0.0095
Further Details:      
 
Domain Number 3 Region: 225-306
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000445
Family DNA polymerase beta-like 0.0072
Further Details:      
 
Domain Number 4 Region: 81-144
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.00000445
Family Achaeal helicase C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226355574|ref|YP_002785314.1|
Sequence length 568
Comment DNA polymerase, family X [Deinococcus deserti VCD115]
Sequence
MAEVTRKALVGVLKTTADLLDLLHLEAFRAQAYRSAARSLEATETDVDALLDSGFAGVPK
VGRGIASELQAYAASGAFGPLEDAASQVPPGVLGLFRVRGLGPKKIRTLWDTGIDSLETL
REACRDGRVAAIKGFGARSAAGILDAVEFALAAQERQHLSTALDVSEMLTAQLEGLDPRI
SGEVGRGLETARAALVTVTATAAELQGRLAGLVEDLQTEADQPLLSGHIDGVPVEVAYAP
AEARGALDLLMGGAATYRDEVEGRAQAQKLTLSREGLHRGATLLPTPTEADVLRALELPY
RPAEYREPEHDSIWESLPTPEKLVTVADLRGMLHTHSVWSDGAATIAHMAEEALRLGHEF
LGTGDHSRAAHYANGLSIERLRAQLREVRELQAAGLPVVAGAEVDILEDGSLDYPDDILA
ELDYVVASVHSHFTLDAARQTDRLVRAASHPLITILGHPTGRLLLRRPGYAMDLDAVLEA
CEVAGTVVEINANAYRLDLDWRDVLRWRGRLTFAVNTDAHVPAGLADTRYGVAVARKAGL
TPAQVVNTLSRTEFLTFVQRQRAGRTTA
Download sequence
Identical sequences C1D136
gi|226355574|ref|YP_002785314.1| 546414.Deide_07030 WP_012692683.1.1337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]