SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226355916|ref|YP_002785656.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226355916|ref|YP_002785656.1|
Domain Number 1 Region: 7-382
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.1e-122
Family ArgJ-like 0.00000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226355916|ref|YP_002785656.1|
Sequence length 385
Comment bifunctional ornithine acetyltransferase/N-acetylglutamate synthase [Deinococcus deserti VCD115]
Sequence
MTDLQLPTGFRAAALAAGIKPSGRTDLSTVVSDADCAWAFAGTRSTTAAACVTRNRDVYA
QGGPVRALLVNAGNANAATGARGAADNADMADALGSVLNVPQDSVLTASTGIIGHLLPMD
RVLSGIEHLPEDLGSGADLFAQAIMTTDTRPKTASVTLSTGARIVGTAKGSGMIHPDMAT
MFAFALTDAQVDQSALRAAFPAIVARTFNAVTVDGDTSTNDMAVVLANGLAGPVPLEEFL
EALEGVMRNLARQIAADGEGATKLLTVRVSGARSEAEALNAARTCCVSPLLKSAVHGNDP
NWGRVIMAVGRSGAAVNVEAMTVSVQGHAVFAGKPLSYDDATVSQSMKAEEVVFEINLGV
GEAVGEAWGCDLSAEYVSINADYTT
Download sequence
Identical sequences C1CUN5
546414.Deide_10200 WP_012693025.1.1337 gi|226355916|ref|YP_002785656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]