SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226356025|ref|YP_002785765.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226356025|ref|YP_002785765.1|
Domain Number 1 Region: 5-393
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.44e-113
Family Homocysteine S-methyltransferase 0.00000818
Further Details:      
 
Domain Number 2 Region: 889-1220
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.75e-111
Family Methionine synthase SAM-binding domain 0.0000000602
Further Details:      
 
Domain Number 3 Region: 350-624
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 3.66e-85
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0014
Further Details:      
 
Domain Number 4 Region: 734-867
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 8.24e-42
Family Cobalamin (vitamin B12)-binding domain 0.00000338
Further Details:      
 
Domain Number 5 Region: 644-730
Classification Level Classification E-value
Superfamily Methionine synthase domain 7.85e-28
Family Methionine synthase domain 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226356025|ref|YP_002785765.1|
Sequence length 1229
Comment B12-dependent methionine synthase [Deinococcus deserti VCD115]
Sequence
MASLHSEAQRRILVLDGAWGTMLQRAGLTEGDFRWDGADPLRMYRGNFDLLQLTRPDVIR
EVHRAYFEAGADIASTNTFNSTVISQADYGTEHLARAMSEAGARLAREVADEFTARDGRP
RWVAGAVGPTNRTATLSPDVERPEFRNVTFDDLVAAYVEQVDGLIAGGADLILIETVFDT
LNAKAALFACEEAFAQAGRTLPIMLSGTITDASGRTLSGQTPEAFVISTEHAQLFSVGLN
CALGADLLRPHLRAVAASSGTLVSVHPNAGLPNAFGEYDETPEHTAAVLRSFAEDGLVNI
VGGCCGTTPDHIRAIAEAVAGLPPRTPPTLPPYLRLSGLEAFTVTPETNFVNVGERTNVT
GSPKFSKAILADDYDSGLKIARQQVVNGAQLVDVNFDEGMLDGEAAMVKFLNLLAGEPDI
SRVPLMLDSSKWEILESGLKRVQGKAVVNSISLKDGEEKFLERARLLRRYGAAAVVMAFD
EQGQADNLERRKEITSRAYRLLTQEAGFPPQDIIFDPNVLTVATGMEEHDRYAIDFIEAT
RWIKENLPGALVSGGISNVSFSFRGNNHVREAMHSVFLYHAIRAGLDMGIVNAGMLAVYE
DIEPELREAVEDVILARRPDATERLITLAESYKGVKREASAQSAWRELPVTERLKHALVS
GITDHVTEDAEEAYQLLGSPLAVIEGPLMDGMNVVGDLFGAGKMFLPQVVKSARVMKRAV
AHLTPYLEAEQTSQSGKGKVLLATVKGDVHDIGKNIVGVVLACNGYQVTDLGVMVSTEKI
LDTASEMGADVIGLSGLITPSLDEMVTVAREMTRRGLKTPLLIGGATTSRAHTAVKIDPA
YDGTVVHVMDASRAVGVVNDLLTQPEAVQERTRDEYASLRERHGERTVRLIPLAQARARA
PQLSPAVPPAPAQPGRQLIEQPIAELLDYIDWTPFFIAWEMKGIYPNILTDPLRGPEARK
LFEDAQALLQRVIAEGTLTARGVIGLWPAHREGDDIVVTAGAQSDTLDHHTHELAAGRAD
FDTEFRLHTLRQQRDQTTPNTALADFVAQQGDHVGAFAVAIHGAEELARAFEAAHDDYNS
ILVKAVADRLAEAFAEKLHRDVRVRHWGYAPDEALANDDLIRERYAGIRPAPGYPAQPDH
TEKRTLFQLLRAEEAGLALTESCAMTPAAAVSGLYFAHPDAQYFAVGRIGRDQVEDYAHR
KGWTLEEAERWLGPLLAYDPARRAEAVAL
Download sequence
Identical sequences C1CUZ4
546414.Deide_11120 gi|226356025|ref|YP_002785765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]