SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226356922|ref|YP_002786662.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226356922|ref|YP_002786662.1|
Domain Number 1 Region: 5-109
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.09e-20
Family Siroheme synthase N-terminal domain-like 0.0069
Further Details:      
 
Domain Number 2 Region: 114-164
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.0000000916
Family Siroheme synthase middle domains-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226356922|ref|YP_002786662.1|
Sequence length 190
Comment precorrin-2 dehydrogenase [Deinococcus deserti VCD115]
Sequence
MLRQMSLLAAFLNLSGQPAVVAGGGRVALRRTQTLLEAGLQVTVVAPQVHPEFSVLPVTV
VQRSCEPADLKDAQVVVAATNDPAVNDRLCAAAHQQGALVNHAGDAALSTLRFPAVISSG
DLQVAVSTGRELPMLAQALGERISALLPDSTTVEQWSRQREEALRETGPGRELALQTLRK
DIRTTMGVPA
Download sequence
Identical sequences 546414.Deide_19160 WP_012694029.1.1337 gi|226356922|ref|YP_002786662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]