SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226357643|ref|YP_002787383.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|226357643|ref|YP_002787383.1|
Domain Number - Region: 3-39
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.0732
Family Siroheme synthase middle domains-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226357643|ref|YP_002787383.1|
Sequence length 136
Comment transposase [Deinococcus deserti VCD115]
Sequence
MIMVDASGVPLAVHTSSASPAEVTLVHDTLEASFGMDFPKRLIGDKAYDSDGLDVELETL
GIEMIAPNRRNRKKTQDGRPLRRYRRRWKVERTIAWLQSFRRVRTRDEVKAQNFLGMVQL
ACIVILLRLVTSPPVP
Download sequence
Identical sequences C1D2J0
546414.Deide_1p01735 gi|226357643|ref|YP_002787383.1|NC_012527 gi|226357643|ref|YP_002787383.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]