SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226355601|ref|YP_002785341.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226355601|ref|YP_002785341.1|
Domain Number 1 Region: 91-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000902
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226355601|ref|YP_002785341.1|
Sequence length 155
Comment hypothetical protein Deide_07290 [Deinococcus deserti VCD115]
Sequence
MDWLPTLERIQSWHWWVLGALLLILEVFAPGVFFVWLAMAAFMLGLLVFVLPLPVTLQLL
LFALLSVVAVLIGRRYVNRLILGGDEGESMNRGASRLVGRTVVVTSAIRNGVGRVRVGDS
DWRATGPDVPEGANVLIVSAEGTTLHVREINGTWV
Download sequence
Identical sequences C1D163
gi|226355601|ref|YP_002785341.1| WP_012692710.1.1337 546414.Deide_07290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]