SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253698869|ref|YP_003020058.1| from Geobacter sp. M21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253698869|ref|YP_003020058.1|
Domain Number 1 Region: 3-300
Classification Level Classification E-value
Superfamily FMN-binding split barrel 7.45e-98
Family UbiD middle domain-like 0.00000109
Further Details:      
 
Domain Number 2 Region: 301-447
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 4.84e-28
Family UbiD C-terminal domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|253698869|ref|YP_003020058.1|
Sequence length 448
Comment UbiD family decarboxylase [Geobacter sp. M21]
Sequence
MAFKDLRGFIAGLEAAGELQRVAAEVDPDLEIACITDRQSKLPGGGKALLFENVKGSPFP
VATNLFGSPARMALALGVAKLDRLSEAMEALLLCPGRAPLPLLVDQAPCREVVELAPDLL
CYPFLKSWPGDGGRFITLPLVFTRDPETGADNCGMYRVRIFDDRSAGVRWKNGSGGWEHY
QKHLASGKRMPVAIAIGADPALTLAASLPLPAGLIEVSLAGYLRGEPVPMLRCLDSDLLV
PADAELVIEGFVEPGVTRNEGDFGNHTGSYDQGEEVPLLTVTCITRRRDPICQATVVGPP
PMEDCWMAKAAERLLLPLIRRQCPEIVDLLLPLEGIFHGCALIGIKKSLPGQGRRVLETL
RLEGWLKRGKLLVAIDATDNPLTLSEGFWRALNAVSFPRDLAVTPDGCLGVDATRKLPEE
GGGQYRELKQDASVSAQVARRWREYGFL
Download sequence
Identical sequences C6E911
gi|253698869|ref|YP_003020058.1| 443144.GM21_0215 WP_012773927.1.50895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]