SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257066826|ref|YP_003153082.1| from Anaerococcus prevotii DSM 20548

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257066826|ref|YP_003153082.1|
Domain Number 1 Region: 5-81
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.000000000000706
Family Cell division protein ZapA-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257066826|ref|YP_003153082.1|
Sequence length 163
Comment hypothetical protein Apre_1338 [Anaerococcus prevotii DSM 20548]
Sequence
MSEYKVDVKIDGKTYTLVSKEPKENIKDIAEIFDRKIQEVKSNRLTFDRQLVLAGVNITD
DLYRLAEKYKSLKEESEVPLRDYPKLKEEVDLIRSEKDKLLRESLEDKERLDELDKENSK
LKRDLVRYKDSKETIDKLKNEVKRLQVEVMDLSKENDSLKGKL
Download sequence
Identical sequences C7RDU8
WP_015778260.1.19141 525919.Apre_1338 gi|257066826|ref|YP_003153082.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]