SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256370769|ref|YP_003108594.1| from Candidatus Sulcia muelleri SMDSEM

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256370769|ref|YP_003108594.1|
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.57e-63
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000128
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.83e-35
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256370769|ref|YP_003108594.1|
Sequence length 327
Comment putative pyruvate dehydrogenase E1 component subunit beta [Candidatus Sulcia muelleri SMDSEM]
Sequence
MKKMTFREVIAAAMSEEMRKDKTIYLMGEEVAEYNGAYKASKGMLKEFGSKRIIDTPISE
LGFSGIGIGSALNGCRPIIEYMTFNFSLVAMDQIINNAAKIRQMSGGQWKIPIVFRGPTG
FAGQLGATHSQSFESWYANCPGLKIVIPSNPYDAKGLLKSSIRDNDVVIFMESEQMYGDK
MMIPIKEYTIPLGIANLKKKGNDLTIVSFGKIIKIALEVALELEKKNISLEIIDLRTIKP
LDYNTIINSIKKTNKLLILEEAWPFASIASEITYVIQQEAFDYLDAPIKRITVQDTPAPY
AKNLIEKWYPSKKDLIENIMNIIYSQE
Download sequence
Identical sequences C7LKF9
595499.SMDSEM_222 gi|256370769|ref|YP_003108594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]