SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256370630|ref|YP_003108455.1| from Candidatus Sulcia muelleri SMDSEM

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256370630|ref|YP_003108455.1|
Domain Number 1 Region: 11-176
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.23e-49
Family TK-like Pyr module 0.002
Further Details:      
 
Domain Number 2 Region: 183-315
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.96e-35
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256370630|ref|YP_003108455.1|
Sequence length 320
Comment putative transketolase, C-terminal subunit, partial [Candidatus Sulcia muelleri SMDSEM]
Sequence
MKLYKNIGMRETRSGFGDALLKLGKENTKIVALCADLTNSLSMTKFSKLFPYRFFQIGIS
EANMMGIAAGLTIGNYIPFTGTFANFATARVYDQIRQSIVYSKKNVKICASHSGISLGED
GATHQSLEDIGMMKMLPGLVVINTCDYNQTYAATIAISKYIGPVYLRFGRPAVPNFTSEK
KLFQIGKAIILNRGEDVTIVSTGHLVWESLEAAKFLKKEGISCEVINIHTIKPLDEESIL
KSVKKTKCIITAEEHNYWGGLGESVARLLSLNYPCSQEIVAVNDTFGESGKPFELMKKYS
LDKETIIKKVKKVIKKKKLY
Download sequence
Identical sequences C7LK20
gi|256370630|ref|YP_003108455.1| 595499.SMDSEM_052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]