SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099032|ref|YP_002533600.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099032|ref|YP_002533600.1|
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.61e-36
Family Single strand DNA-binding domain, SSB 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222099032|ref|YP_002533600.1|
Sequence length 142
Comment Single-stranded DNA-binding protein [Thermotoga neapolitana DSM 4359]
Sequence
MSFFNRIILIGRLVRDPEERYTLSGTPVTTFTIAVDRVPRKNAPDDAQTTDFFRVVTFGR
LAEFARTYLTKGRLILVEGEMRMRRWETQTGEKRVSPEVVANVVRFMDRKPVEMPSEDIE
EKLEIPEEDFTDDTFSEDEPPF
Download sequence
Identical sequences B9KB38 D1M925
gi|222099032|ref|YP_002533600.1| WP_012644944.1.34263 WP_012644944.1.6313 309803.CTN_0058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]