SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099059|ref|YP_002533627.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099059|ref|YP_002533627.1|
Domain Number 1 Region: 2-215
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.75e-57
Family PP-loop ATPase 0.0000323
Further Details:      
 
Domain Number 2 Region: 326-395
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000000288
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222099059|ref|YP_002533627.1|
Sequence length 419
Comment tRNA(Ile)-lysidine synthase [Thermotoga neapolitana DSM 4359]
Sequence
MKENRLIGEGDIVLVAVSGGIDSMTLLYILKKLSPLLKIEVLGAHLDHRIRESSERDRKF
VEDICRQWNVPVETAVVDVPALWKGSGKTLEEVAREVRYSFLEKVAKKLGATKIALAHHK
NDLLETVLHRLVRGTGPLGIACIPVKREKYIRPFLVFKRSEIEDYAQKQKIPFVVDETNY
DIKYTRNFIRHRVVPLLKKLNPNVEDAVYRLVSISFMLREFVEETVQNFVKEKVHFYKDF
AVFEEPKNQFLFLEVTRWVLKTLYGRTPDYEKLIESLKSRRVELWKDVFVERSFGYGAVG
KTLFKKKYRLEVKDGIFDIEGFKIKVNLHGIERAFWLRNRRKGDRIIINGSEEKLKDIFI
EKKVPVFYRDRVPLLVDEQGRVLWVPGIAFSDEFPPEVNVELLEFPIGYVKGGTSFEQV
Download sequence
Identical sequences B9KB65
309803.CTN_0085 gi|222099059|ref|YP_002533627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]