SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099403|ref|YP_002533971.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099403|ref|YP_002533971.1|
Domain Number 1 Region: 166-306
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.51e-23
Family HD domain 0.017
Further Details:      
 
Domain Number 2 Region: 20-108
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000926
Family Single strand DNA-binding domain, SSB 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222099403|ref|YP_002533971.1|
Sequence length 340
Comment Metal dependent phosphohydrolase [Thermotoga neapolitana DSM 4359]
Sequence
MSELKLGDLMPKDLLGQELFVQDLKDHINDNVEIVLKIRSKKLQETKDNKKFLIMTLEDR
TGAVRAVDWYNAELNDQRLKEGSVVKVKGRVVFFENRIQINVENDYNAIRVLKKDEYDFS
KFVAQSKKDLEVMKKKLFSLIDQIKDRDYKRLLRAFFVEDEEFSEKFFKSPAGMRVHHAY
IGGLLEHSLTVAEICREISRYYPVDRDLLITGALLHDVGKVREYVVTESGIDVTTEGELK
GHISIGAMMVREKAKELGLPEKKVLEVEHIILSHHGELEWGSPVVPKTIEALIVHHVENL
DSKLARFFEIIENADSDQVWTEYDKNLKRRIFIRGEELNE
Download sequence
Identical sequences B9KC59
309803.CTN_0429 gi|222099403|ref|YP_002533971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]