SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099455|ref|YP_002534023.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099455|ref|YP_002534023.1|
Domain Number 1 Region: 256-519
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.18e-69
Family Tandem AAA-ATPase domain 0.000000000628
Further Details:      
 
Domain Number 2 Region: 80-251
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.01e-51
Family RecG "wedge" domain 0.0000000951
Further Details:      
 
Domain Number 3 Region: 458-667
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.77e-44
Family Tandem AAA-ATPase domain 0.0000000725
Further Details:      
 
Domain Number 4 Region: 2-73
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 7.59e-19
Family RecG, N-terminal domain 0.0000643
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222099455|ref|YP_002534023.1|
Sequence length 750
Comment ATP-dependent DNA helicase RecG [Thermotoga neapolitana DSM 4359]
Sequence
MLKDQIDEKKILQLHRELDDPLLENEDLKNKLRAFVDYVREIPHLPEPRKRYRVGKTFEM
IEKLRKWYLIEYLNCSSAEKIDLSTDVQYARGVGPGRKKKLKKLGIETLKDLLEFFPRDY
EDRRKVLKLNELIPGRKVTTQGKISSVEKKKFQNMNILVAVLSDGLMHVLLKWFNQDFLL
TQLKQLVGKEVFVTGTVKLNPYTGQYEIHNAEVLPKEREIIRRIFPIYRLTSGISQKQMR
RIFEENIPSLCCSLEETLPERIIKKRNLLSIKDAYYGMHFPKTLHHLEKARERLAYEELF
TLQLAFQKVRREREKHGGIPKKIEGRLAEEFIKSLPFQLTGAQKRAHEEIRKDMISEKPM
NRLLQGDVGSGKTVVAQLAILDNYEAGFQAAFMVPTSILAIQHYRRTMESFSRFDIRVAL
LIGATSPSEKEKIKSGLKNGQIDLVIGTHALIQEDVHFKNLGLVIIDEQHRFGVRQREAL
MNKGRMVDTLVMSATPIPRSMALAFYGDLDVTVIDEMPPGRKEVQTILVSMDRVNEVYEF
VRQEVMKGGQAFIVYPLIEESDKLSAKSAVEMYEYLSREVFPEFRVGLMHGKLSQEEKDR
VMMEFAEGRYDILVSTTVIEVGIDVPRANVMVIENPERFGLAQLHQLRGRVGRGGQEAYC
FLVVGDVGEEAMERLRFFTLNTDGFKIAEYDLKTRGPGEFFGLKQHGMSGFKVANLYKDL
KLLEWAREDVREIDVDKIDLPEEIKLIEVG
Download sequence
Identical sequences B9K6S4
309803.CTN_0481 gi|222099455|ref|YP_002534023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]