SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099496|ref|YP_002534064.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099496|ref|YP_002534064.1|
Domain Number 1 Region: 69-140
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.32e-19
Family DNA helicase RuvA subunit, middle domain 0.0055
Further Details:      
 
Domain Number 2 Region: 146-190
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.0000000000497
Family DNA helicase RuvA subunit, C-terminal domain 0.0034
Further Details:      
 
Domain Number 3 Region: 5-66
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000148
Family DNA helicase RuvA subunit, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222099496|ref|YP_002534064.1|
Sequence length 191
Comment Holliday junction DNA helicase RuvA [Thermotoga neapolitana DSM 4359]
Sequence
MVPVIAGIYGKVVEKNGNTVFVSTNSGIVFEIACDTQTCEELEENRECYLYTFLSVSQDG
VALYGFSDRKKKDLFLSLMKVSRLGPKTALKILSSEDVDTLISMINSQDVEGLSKIPGIS
RKTAERIVMELKGKFESTVLKDLKTYHESLEALVSLGYPEKQARKAIKEVLKDGMSTSEV
IKEALRILSRR
Download sequence
Identical sequences B9K6W5 Q5CBR2
gi|222099496|ref|YP_002534064.1| 309803.CTN_0522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]