SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099565|ref|YP_002534133.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099565|ref|YP_002534133.1|
Domain Number 1 Region: 13-322
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 6.66e-124
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000031
Further Details:      
 
Domain Number 2 Region: 411-590
Classification Level Classification E-value
Superfamily RuvA domain 2-like 9.64e-57
Family NAD+-dependent DNA ligase, domain 3 0.0000353
Further Details:      
 
Domain Number 3 Region: 323-406
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.65e-28
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00024
Further Details:      
 
Domain Number 4 Region: 595-677
Classification Level Classification E-value
Superfamily BRCT domain 8.14e-21
Family DNA ligase 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222099565|ref|YP_002534133.1|
Sequence length 693
Comment DNA ligase [Thermotoga neapolitana DSM 4359]
Sequence
MFRGGEKMRQIPKEVIEEVERLREEIEYHNYRYYVLNDPVITDEEYDRLMRRLIELERMY
PELVTPDSPTQRVGGKVLEGFKTVKHSVPMLSLDNTYNEEEIIEFDKRVKKTLQESEVEY
VAELKIDGVSIALRYENGRFVLGATRGDGVEGEDVSENVKTIRSVPLRLRKPLTIEVRGE
IYMPVDEFKRLNEEREEEGLPPFANPRNAAAGTLRQLNTALVASRRLDSFIYYVVHPENY
GLKTQWEALQFLKEIGFKVNPHSRLCKNIQEVIEYWREWKERKRELDYWVDGVVVKVNRF
DFQKVLGETSKAPRWAIAFKFPAEQARTRILDVTIQVGRTGVLTPVAELEPVQLAGTIVK
RASLHNFEYIREKDIRIGDYVFVEKAGGIIPQIVKSIPELRTGSEKEIKPPQSCPVCGGK
VGKLSPDEVAIRCLNPHCPAKLKRALRTFVSREALDIEGLGEKIIDRLVDSGLVKDIADI
FYLTPFDLAQLGPGIGQRTIAKILQEIEEAKKRPLHKLITGLGIPMVGQKTAKILAEHFK
SLEAIAEASYETLKDIPGIGPEIARSIVEYFRNPKTREIIEKLKKAGVKLEEKTVKYDVL
KGLTFAVTGTLKNFTREEIIEFLERLGARVVNSVSKNTDYLIVGENPGSKYEKAKALKVK
TMSEEEFLRFVENRAKLKGYNFDEIMRGWKEWS
Download sequence
Identical sequences B9K734
309803.CTN_0591 gi|222099565|ref|YP_002534133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]