SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099824|ref|YP_002534392.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099824|ref|YP_002534392.1|
Domain Number 1 Region: 3-255
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.56e-49
Family DegV-like 0.0000827
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222099824|ref|YP_002534392.1|
Sequence length 258
Comment DegV family protein [Thermotoga neapolitana DSM 4359]
Sequence
MKTVGIKVYIDDREFTDGVDLDSETFYSFFGRAKDFRTAVPSPVEMEKVLRDIISEGYTR
IYCVHLSAKLSAFYSVMNGVVERLEEEFPDVEFKVIDTRQVSIGAGYVLLELMRAVERGE
EDLETVVENVNRRIKIRFSVLEFNYLIKSGRVRATVGILGNLAKIFPIMSLENGELKVVA
KKRGLKNVVEKIVEDLKTEKPRMLGLAYAGEEMKEIVLELKARLQDDKVERVDIVRLPPT
LAVHSGPKMFGAGILTLE
Download sequence
Identical sequences B9K7U3
309803.CTN_0850 gi|222099824|ref|YP_002534392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]