SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099826|ref|YP_002534394.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|222099826|ref|YP_002534394.1|
Domain Number - Region: 2-60
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0857
Family Cold shock DNA-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222099826|ref|YP_002534394.1|
Sequence length 417
Comment Ribonuclease, Rne/Rng family [Thermotoga neapolitana DSM 4359]
Sequence
MKIGKGRNAFLKLNEINESYREIVLKGQEVTEGAKVLVQVKKDASGKKGPQVTAQIGIAD
RFVVVFPFKKVVGVSRKIENRLERRRLRSLAIDLRKRYGIGVIIRTAAEGVEEEEIVKNF
QEAMNKWNEVLQKFRRSRKPKLLYEEDPIEQIVKEKVNSKIDRLIYNEKSILSTLEKYVQ
TLPKRPELVYTEGDLFEKYFIYDRLKQLLSRTVPLKSGGNIVIDRTEALTVIDVNSESYT
DAENQEELALKTNLEAIEEIIRQLILRNIGGIVVVDFIKQRDPKNYEKILERFKELAKKD
GTKIEVFGFTNLGLLEMTRKRTTRPLDAFLFTRCPVCGGTGKVISQKVLLKRIKEDLKKL
REFDEVTLKLHPNMSGYFKKEDVKRLEREFKVKISLDYTWNDPNSYELSAKTKKGGK
Download sequence
Identical sequences B9K7U5
309803.CTN_0852 gi|222099826|ref|YP_002534394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]