SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099867|ref|YP_002534435.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099867|ref|YP_002534435.1|
Domain Number 1 Region: 149-485
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.25e-112
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000178
Further Details:      
 
Domain Number 2 Region: 3-142
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.61e-41
Family Anticodon-binding domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222099867|ref|YP_002534435.1|
Sequence length 502
Comment lysyl-tRNA synthetase [Thermotoga neapolitana DSM 4359]
Sequence
MLKEFKEQRIREIQELRSMNIEPYPYRFEKEMSASEIKEKYDHLQAGEVQESEKLSFAGR
VMSIRHHGKTAFFHLKDDTGRIQAYIRADAVGKDRMGLFKKHVKIGDFVGVRGFPFKSKT
GELTIYVEDFTLLSKALRPLPEKWHGIKDKEIIYRQRYLELIMSDEAIERFKKRFEAMRV
IREFLNSRGFVEVETPILHYVTGGAEARPFVTHLNVFDVDMYLRIAPELYLKRLIVGGFE
KIYEIGKNFRNEGISYKHSPEFTSIEIYQAYADYNDMMNLTEELIVEVVKRTCGTLKITY
QGKEIDFTPPWRRVRMRDFLKEKLGVDILEDSDEVLLKKLEEHGVEVEIKNRAHLIDKLR
DIVEEELVNPTFIIDHPVDISPLAKRHREDPRLTERFELIIFGREIANAFSELNDPIDQY
QRFLEQMKMREEGDEEAHMMDLDFVRALEYGMPPTGGLGIGLDRLFMFITDSPTIRDIIP
FPLVKPKKFEEEEAEFEGGVME
Download sequence
Identical sequences A0A0B5KQX7 B9K7Y6
WP_015919386.1.23678 WP_015919386.1.34263 WP_015919386.1.6313 309803.CTN_0893 gi|222099867|ref|YP_002534435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]