SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099927|ref|YP_002534495.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099927|ref|YP_002534495.1|
Domain Number 1 Region: 128-185
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.52e-19
Family Cold shock DNA-binding domain-like 0.00042
Further Details:      
 
Domain Number 2 Region: 68-127
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.57e-18
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 
Domain Number 3 Region: 1-62
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.15e-17
Family eIF5a N-terminal domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222099927|ref|YP_002534495.1|
Sequence length 185
Comment elongation factor P [Thermotoga neapolitana DSM 4359]
Sequence
MIEVGDLKKGMFIIYDGEIYRVLEASKHFMGRGSGLVRTKLKNVKTGLVREVNFPSGEKV
PEAELSFRKAQYLYRDGDHYYFMTLDDYEQHALSEEEIGDAKYYLVENMEVDLVFHEGVP
IGVELPTTVELTVVETEPSFKGDTVSGGGKPAVLETGLKITVPYFIETGDKIKVDTRTGE
YVGRA
Download sequence
Identical sequences A0A0B5KKX4 B9K846
gi|222099927|ref|YP_002534495.1| 309803.CTN_0953 WP_015919446.1.23678 WP_015919446.1.34263 WP_015919446.1.6313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]