SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099932|ref|YP_002534500.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|222099932|ref|YP_002534500.1|
Domain Number - Region: 166-294
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0147
Family Clp protease, ClpP subunit 0.072
Further Details:      
 
Domain Number - Region: 20-64
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0707
Family Single strand DNA-binding domain, SSB 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222099932|ref|YP_002534500.1|
Sequence length 393
Comment Exodeoxyribonuclease 7 large subunit [Thermotoga neapolitana DSM 4359]
Sequence
MREIVYTVTEISEYIKKLLEEDPYLVNVSVYGEITNVRPRKGHIFFSLVDENAKLDCVLF
GGDNMGIRLQEGKMALVDGSISVYTPHGTYRFVCSNIRYLDHIGTYQMKFETTLKKLLEE
GLLYRPKRPLPRFPRRIGVITSRSSAAFHDVIRTAKERKSPVEIYLFHTSVQGDSAKKEL
IEALRKANEYDLDLVLIVRGGGSREDLWVFNEEEVVREILKMKHPVVTGIGHEIDRVIAD
FVADVSMHTPTGAAEYVLPDLRDVHEELKNLYERMKDAVLEKITREEERLNRLFHYIKAA
AKRKYEINKLTAIRVKEMAGKLRSLVLNSVRRKQERVEHLFRVLESLKPTRFLDKGFVLV
KKEGKIVKEAASLNSGDIVFLIFRDGEKKARVI
Download sequence
Identical sequences A0A0B5KKY0 B9K851
WP_015919451.1.23678 WP_015919451.1.34263 WP_015919451.1.6313 309803.CTN_0958 gi|222099932|ref|YP_002534500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]