SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099941|ref|YP_002534509.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099941|ref|YP_002534509.1|
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 3.92e-44
Family Transcription factor NusA, N-terminal domain 0.000000661
Further Details:      
 
Domain Number 2 Region: 200-277
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.96e-28
Family Prokaryotic type KH domain (KH-domain type II) 0.00001
Further Details:      
 
Domain Number 3 Region: 277-341
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 2.16e-17
Family Prokaryotic type KH domain (KH-domain type II) 0.0000236
Further Details:      
 
Domain Number 4 Region: 132-198
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000309
Family Cold shock DNA-binding domain-like 0.0000424
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222099941|ref|YP_002534509.1|
Sequence length 344
Comment transcription elongation factor NusA [Thermotoga neapolitana DSM 4359]
Sequence
MNIGLLEALDQLEEEKGISKEEVIPILEKALVSAYRKNFGSSKNVEVVIDRNTGNIKVYQ
LLEVVENVEDSTTQISLEEAKKLDPTAEIGSIIKKELDVKNFGRIAAQTAKQVLIQRIRE
LEKEKQFEKYSELKGTVTTAEVIRVTSDWADIRIGKLETRLPKKEWIPGEEIKPGDLVKV
YIIDVVKTTKGPKILVSRRVPEFVIGLMKLEIPEIENGIVEIKAIAREPGVRTKVAVTSN
NPNVDPIGACIGEGGSRIAAILRELKGEKLDVLKWSDDPKQLIANALAPATVIEVEILDK
ENRAARVLVPPTQLSLAIGKGGQNARLAAKLTGWKIDIKPIMNL
Download sequence
Identical sequences B9K860
309803.CTN_0967 gi|222099941|ref|YP_002534509.1| WP_015919460.1.34263 WP_015919460.1.6313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]