SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099970|ref|YP_002534538.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099970|ref|YP_002534538.1|
Domain Number 1 Region: 127-272
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.23e-61
Family C-terminal domain of ribosomal protein L2 0.000000903
Further Details:      
 
Domain Number 2 Region: 3-126
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-54
Family Cold shock DNA-binding domain-like 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222099970|ref|YP_002534538.1|
Sequence length 276
Comment 50S ribosomal protein L2 [Thermotoga neapolitana DSM 4359]
Sequence
MGLKRFKPVTPGRRFMVISDFSDITKTEPEKSLLAPLKKTGGRNHHGRITVRHRGGGHKR
RYRIIDFKRYDKAGIPAKVLAIEYDPNRSARIALLLYADGEKRYILAPKGIKVGDTLMSG
SDAEIKPGNALPLEKIPVGTLVHNVEFTPGKGGQIARAAGTYCQIMAKEGDYALLRMPSG
ELRKVHIKCYATVGVVGNEDHKNEVHGKAGRVRWLGRRPHVRGVAMNPVDHPHGGGEGRG
KGHHPTSPWGLPTKGYKTRRGKRPSDKFIVRRRNEV
Download sequence
Identical sequences A0A0B5KX54 B9K889
gi|222099970|ref|YP_002534538.1| WP_015919489.1.23678 WP_015919489.1.34263 WP_015919489.1.6313 309803.CTN_0996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]