SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099976|ref|YP_002534544.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099976|ref|YP_002534544.1|
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.28e-37
Family Cold shock DNA-binding domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222099976|ref|YP_002534544.1|
Sequence length 112
Comment 30S ribosomal protein S17 [Thermotoga neapolitana DSM 4359]
Sequence
MPRKRMIGVVVSDKMDKTVVVAVERHVQHPLYKKYIKRTKKYHAHDEKNECRVGDVVEIE
ETRPLSKTKRWRVVKIIKRFEPERILKEEEEVQDELEEIEGEVVEEKGGAES
Download sequence
Identical sequences A0A0B5KZC1 B9K895
WP_015919495.1.23678 WP_015919495.1.34263 gi|222099976|ref|YP_002534544.1| 309803.CTN_1002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]