SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222099997|ref|YP_002534565.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222099997|ref|YP_002534565.1|
Domain Number 1 Region: 118-395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.87e-66
Family RecA protein-like (ATPase-domain) 0.000000136
Further Details:      
 
Domain Number 2 Region: 77-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-24
Family Cold shock DNA-binding domain-like 0.00014
Further Details:      
 
Domain Number 3 Region: 29-73
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000000000667
Family Rho termination factor, N-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222099997|ref|YP_002534565.1|
Sequence length 447
Comment transcription termination factor Rho [Thermotoga neapolitana DSM 4359]
Sequence
MPPFFFPAFSSFHQFPGGEKLSEEQKTISISELESMNIKQLYEIAKSLGIPRYTSLRKRD
LIFAILKAQTESSGYFFGEGVLEIHPEGFGFLRRIEDNLLPSNDDIYISPSQIRKFNLNT
GDIISGVIRKPKEGEKYFAMIKIEAINYRPVETASERVNFDNLTPDYPRERFILETNPKI
FSTRLIDLFAPIGKGQRGMIVAPPKAGKTTILKEIANGIAENHPDTIRIILLIDERPEEV
TDIKESTNAIVIAAPFDMPPDKQVKVAELTLEMAKRLVEFNYDVVILLDSLTRLARVYNI
VVPPSGKLLTGGVDPAALYKPKRFFGAARNTREGGSLTIIATALVETGSKMDEVIFEEFK
GTGNMELVLSRQLANKRIFPAINLLLSGTRREELLLDEETLKKVWLLRRMLSAMTEEEGL
TLILNKLAETSSNEEFLKLIDKEKARY
Download sequence
Identical sequences B9K8B6
gi|222099997|ref|YP_002534565.1| 309803.CTN_1023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]