SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222100022|ref|YP_002534590.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222100022|ref|YP_002534590.1|
Domain Number 1 Region: 338-445
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.86e-27
Family Cold shock DNA-binding domain-like 0.0048
Further Details:      
 
Domain Number 2 Region: 252-356
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.5e-25
Family Cold shock DNA-binding domain-like 0.0053
Further Details:      
 
Domain Number 3 Region: 161-274
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.88e-24
Family Cold shock DNA-binding domain-like 0.0079
Further Details:      
 
Domain Number 4 Region: 12-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000858
Family Cold shock DNA-binding domain-like 0.025
Further Details:      
 
Domain Number 5 Region: 425-508
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000149
Family Cold shock DNA-binding domain-like 0.014
Further Details:      
 
Domain Number 6 Region: 95-172
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000119
Family Cold shock DNA-binding domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222100022|ref|YP_002534590.1|
Sequence length 539
Comment RNA binding S1 domain protein [Thermotoga neapolitana DSM 4359]
Sequence
MEFNDEILNQYEPGEFRRGQIVKGTVIGKEEDGIVVDFGGKSEGFVPEGELIRPMDDYKI
GEELTLQILNLNYEERSTLSEKRPIFRKTMEELRKLYEEGKPVKARIVSQAKGGYNVVLK
GVVPAFLPGSHSLLKREEPFPREEIEVLILDMAHTRRGTRIVVSRKAIQERKVDEFFSEK
KTGDVVECTVRRINPSGIEVEVSDGIRGFIPRSELSYDTRITPEDVVQVGQKVTAKIIEL
DKDRRSVVLSLKQLMPDPWNKVEEKYPVGKVVSGEVTSIHPFGFFVRLEPGVEGLVPRSE
VFWGNSRKNLEDVVKVGDLVKVEVINVDRENRKLTLSYRKAKGDPWENIEDRYHVGNTVA
GRVISIIRQGVFVELEEGIEGFVPISELSWKRVDSPEEVVKVGEKVKVKIMNLDKENRRL
SLSIKRTQENPWKRALEELEKDSIVRGTVKKVVNSGVIVQVEEYDVEGFVPNNHLVSEPE
EGKLLNLVVLRIDPDEIFGGRMILSEKRFEERMNIEEYKKKVEEESYQKSLGDLLKNGE
Download sequence
Identical sequences B9K8E1
gi|222100022|ref|YP_002534590.1| 309803.CTN_1048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]