SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222100026|ref|YP_002534594.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222100026|ref|YP_002534594.1|
Domain Number 1 Region: 110-292,420-576
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.47e-107
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000035
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.12e-32
Family Anticodon-binding domain 0.00022
Further Details:      
 
Domain Number 3 Region: 289-412
Classification Level Classification E-value
Superfamily GAD domain-like 8.34e-26
Family GAD domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222100026|ref|YP_002534594.1|
Sequence length 579
Comment aspartyl-tRNA synthetase [Thermotoga neapolitana DSM 4359]
Sequence
MLRTHTCGELRVEDEGKKVKLCGWVDRIRDLGGVRFIDLRDRYGETQIVCDVNSKAYETV
DELTRESVVLVEGTVRRRPEGTENPNIATGEIEVVAERIEILSKAEPLPFYPNETPKEEM
RLRYRYIDLRSKRMRDNIILRYNITRVIRRYFDELGFLEIETPFLTKSTPEGARDFLVPS
RLRPGKFYALPQSPQLFKQLLMISGFDRYFQIVRCFRDEDLRADRQPEFTQVDVEMSFVD
VEDVLSVSEGMIARVFREAIGMDLKTPFDRITYSEAMEKYGTDKPDRRYGMELRDLGYAF
EGTTFRVIRSVLEEGGSVKGFVVPEFASEMTRKKGDELMERAKELGLGGLIWFKVEEKIV
SPHLKHLEREFKTIVEKENLKEGDVCLIAAHKDRNLLNEALGTLRLEIGKEYFSHLAKGF
DILWVVDFPYFEWSEEEERFVARHHPFTMPVEETLGDDHTKVKAKAYDIVINGYEVGGGS
IRIHKREIQEKIFKLLGMREEEAREKFGFFLEAFKYGVPPHGGIAFGLDRLVAIIAGENS
IREVIPFPKTGNGVCLLTGAPSSVDEKQLRELRIRVEEG
Download sequence
Identical sequences B9K8E5
309803.CTN_1052 WP_015919544.1.34263 WP_015919544.1.6313 gi|222100026|ref|YP_002534594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]