SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222100220|ref|YP_002534788.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222100220|ref|YP_002534788.1|
Domain Number 1 Region: 295-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-52
Family Ribonuclease PH domain 1-like 0.0000181
Further Details:      
 
Domain Number 2 Region: 6-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-45
Family Ribonuclease PH domain 1-like 0.0000301
Further Details:      
 
Domain Number 3 Region: 452-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.91e-28
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 142-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-26
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 5 Region: 559-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 620-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000493
Family Cold shock DNA-binding domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222100220|ref|YP_002534788.1|
Sequence length 707
Comment polynucleotide phosphorylase/polyadenylase [Thermotoga neapolitana DSM 4359]
Sequence
MKEWRREILGRELVVQHGKVAKQSSGAVLVRFGDTAVLATANISDKVIEGIDFVPLTVEF
QERFYAAGKIPGGFIKREGKPSESAILSARLIDRPIRPLFPKKLRNEIQVIVTVLSADPN
VPPDVVGIFAVSLALNVSKIPFEGIVAGIRIGYRDGQFIAFPTEEDIEKGLMDITVAGTK
DAVTMVEGEAKEVSEEDMVKALRFAHSVIKELVDFQEEILSEFNVEKIPVVEPEPPEGLV
ETFNSLLDREELERRILVKAKKEREAALKEYEEKLLSQTAEALSIVDPEEIKPFVSELYE
EAVKKTMRRLIVEKGIRADGRKPNEIRPISCEVGLFPRTHGSALFTRGETQSLGIVTLGA
PMDVQIIDTLLEEGVKRFMLHYNFPPFCTGEVKPLRGPSRREIGHGHLAERALKNMLPPE
EEFPYTIRVVSEILESNGSSSMATVCSGSLALMDAGVPIRKHVAGIAMGLILEEDAEVIL
TDIIGMEDHYGDMDFKVAGTRDGITAFQMDCKVSGVSDELLMKALMQAREARMYILDKMY
ETISAPRPHLSRYAPIIKVTKIDPDKVADVIGPGGRVIKKIIKDFDVKVEIDDETGLVKV
VGNSEENVDNAIALIREIAKEIEVGEILEGKITRIEPYGLFIEVRPGKIGLLHQSKVGED
MRQFLKKVKVGDTIKVQVINIDDLGRLQFKRVKEESPQHGEVHNKRH
Download sequence
Identical sequences A0A0B5L3Z2 B9K8Y9
309803.CTN_1246 WP_015919737.1.23678 WP_015919737.1.34263 gi|222100220|ref|YP_002534788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]