SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222100448|ref|YP_002535016.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222100448|ref|YP_002535016.1|
Domain Number 1 Region: 62-436
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.36e-77
Family (Uracil-5-)-methyltransferase 0.00012
Further Details:      
 
Domain Number 2 Region: 4-60
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000628
Family TRAM domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222100448|ref|YP_002535016.1|
Sequence length 439
Comment RNA methyltransferase, TrmA family [Thermotoga neapolitana DSM 4359]
Sequence
MLEHVRIDKMVNGGYGLARLQNGKIVLVEGAYPGEEALIKTFREKKDFAFGKVVSLIKES
EDRVKPPCRYFGRCGGCHWMDIRYEKQLLYKKEIVEDLFERMKLDVEVEDVEPSDLVFHY
RTKMEFHLQGKRLGLKRRGSDFVIDIRSCEVAPEGTGEILEIVRKAVQVLNIPVYNRLTR
KGVLKHVVIRYAFSTDQLMVIFVTKTESFPWGKSLVQAILKDIPKVHSIIHVMNSKDSVV
LRGPYRTLYGEGVIVEEFDWEKFQIPPTAFFQSNYSVTSKLIDHVYRELDLQGNEVVLDL
YAGIGTFSMRTSYSSARVIAVESSRVAVKAGKANANVNGRRNIEYIESDVLDFLKSYQGR
ADKVILDPPRSGAGLDVMKEILRLSPERVVYVSCEPSTLVRDVQFLQNEGYSVVRVKPFD
MFPQTYHVETVVTLVKGER
Download sequence
Identical sequences A0A0B5L4H4 B9K9L7
309803.CTN_1474 WP_015919939.1.23678 WP_015919939.1.34263 WP_015919939.1.6313 gi|222100448|ref|YP_002535016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]