SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222100458|ref|YP_002535026.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222100458|ref|YP_002535026.1|
Domain Number 1 Region: 16-361
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.38e-111
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000176
Further Details:      
 
Domain Number 2 Region: 364-556
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.12e-42
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00024
Further Details:      
 
Domain Number 3 Region: 542-642
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.54e-34
Family Myf domain 0.0000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222100458|ref|YP_002535026.1|
Sequence length 643
Comment Methionyl-tRNA synthetase [Thermotoga neapolitana DSM 4359]
Sequence
MISLNRKGVLGGDILKFYITTPIYYVNSEPHIGSAYTTIVADIIARYKRFMGYDVFFLTG
TDEHGQKVLQAAQQAGKDPQKFCDELAEKFKQLWKELKITNDHFIRTTDETHMKTVQEFV
AKMKENGDVYKGVYKGWYCVPCETFWNEDEVVKEGDERLCPECRRPVKWVEEENYFFRLS
KYRDALLKHYEEHPDFVEPDFRRNEMLKILEGGLKDLSITRTSFKWGVPMKDDPEHVIYV
WVDALINYVSAIGYGWNEEMFNRWWPADLHLIGKEINRFHSIIWPAMLMSVGLPLPEKVF
AHGWLTVNGQKISKSLGNAIDPRFFVKRYGNDVVRYYLIRDIVFGKDGDFSEERLVHRLN
SDLANDYGNLLHRITAMINKYFNGKLPSPANEEGPDGWLKERFFETKNAYYDLMDSYRLT
EALDRIWEFIADANKYFNDTKPWVLAKEGKSERLGTVLYNSLEAVFKVALMTLPVMPDTS
QEVFRRVSFDENPHRNHLETWGVLRAGRSVHHGEPLFRKIDTKTFKKVVETVSVEQNLIT
IDDFAKVDLRTARVLEAEKVPNSRKLIKLIVDLGTEKRQIVAGIAEYYKPEDLVGKTIIV
VANLKPAKLMGIESQGMLLAAKAGDTLRLLTVDGDIAPGARVS
Download sequence
Identical sequences B9K9M7
gi|222100458|ref|YP_002535026.1| 309803.CTN_1484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]