SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222100836|ref|YP_002535404.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222100836|ref|YP_002535404.1|
Domain Number 1 Region: 203-621
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.31e-142
Family RNB domain-like 0.0000037
Further Details:      
 
Domain Number 2 Region: 121-216
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-19
Family Cold shock DNA-binding domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 622-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.12e-18
Family Cold shock DNA-binding domain-like 0.0037
Further Details:      
 
Domain Number 4 Region: 65-129
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000497
Family Cold shock DNA-binding domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222100836|ref|YP_002535404.1|
Sequence length 710
Comment Ribonuclease R [Thermotoga neapolitana DSM 4359]
Sequence
MSLKKEVERFILSEDYKPMVLKEIYKRFKAKTREKRRKIREVVKKLEKEGKIFRDSKGRY
RKLGEDLKVGTIEFTRSGYVAFVITDEFEEIAVPVEDTKYAMHKDRVVVEIVGTWRGLPR
GRVVRVLERGLKRVVGVFDHKGTFGFVVPDDPKIAYDFYVAPENIDGAKPNQKVIAEILK
YPSPGRNPEARVVKVLGDLDDPSIDLPSVIVKHDLPEPGEFPEEVLKEANAIPSRVRKKD
LVGRKDMRDRVIVTIDGEDAKDFDDAISVEKLPNGNYLLGVHIADVSHYVKEGSALDQEA
FRRGTSVYLIDTVIPMLPFRLSNGICSLVEGKDRLTMSVEMEIDREGRVVKYDVFPSVIR
SKKRMIYERVNEFLEDPSSVKEYEPFSELIHNAVELAEILREARRKRGAIIDIESDEVKV
VLDENGQVVDIVPRKRGIAERLIEEFMIRANETIAEIFDHAGLPFMYRVHEEPDPETIFQ
LKNYLEAMGIRAKFSHNIHPGMLQKLLEKVKDHPLRSSVERLLVRSMKRAMYSAVNIGHF
GLASYAYTHFTSPIRRYPDLVVHRLLKLYLEQNGYFTPEQIDKFSKVLPKIAKHCSRRER
VADEAEWDLIAMKKVEYISRHIGEVFDVVVTNITKFGLFVEIPEKSISGLVHISTLDDYY
YYDESKNMLIGRRKGRIFRLGDVLKAKVVRADKIRGEIDFELVEKEEKEG
Download sequence
Identical sequences B9KAQ5
gi|222100836|ref|YP_002535404.1| 309803.CTN_1862 WP_015920274.1.34263 WP_015920274.1.6313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]