SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222100855|ref|YP_002535423.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222100855|ref|YP_002535423.1|
Domain Number 1 Region: 221-324
Classification Level Classification E-value
Superfamily Protein-L-isoaspartyl O-methyltransferase, C-terminal domain 4.71e-48
Family Protein-L-isoaspartyl O-methyltransferase, C-terminal domain 0.00000611
Further Details:      
 
Domain Number 2 Region: 14-187,223-235
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.36e-42
Family Protein-L-isoaspartyl O-methyltransferase 0.00000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222100855|ref|YP_002535423.1|
Sequence length 324
Comment protein-L-isoaspartate O-methyltransferase [Thermotoga neapolitana DSM 4359]
Sequence
MITQGDVMRERLFWILKNHGISDRIAKAFLEVPREEFLTRHYPLSYVYEDTVLVSYEDGE
VFSTSSQPSLMAMFMEWVDLDEGMRVLEIGGGTGYNAAVMSRVVGKKGLVVTVEYFEEVC
RIARENMRRLGIENVVVVCGDGYYGVSDFAPYDVIFVTVGVDEVPEHWFCQLKDGGRVIV
PINMKISARQPAFLFVKNGSHLEGGYKLETRFIKAGGNLGNLLERNRRLLRDFPFQKAIR
VPRLQVFVELVDLLTRRLAEMNGIFYYAGPEGTVEFLNGEMRIYGRAPEIESLLSQWEEC
GYRSFEHLMLHIGYNAVSYISCTI
Download sequence
Identical sequences B9KAS4
gi|222100855|ref|YP_002535423.1| 309803.CTN_1881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]