SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222100728|ref|YP_002535296.1| from Thermotoga neapolitana DSM 4359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222100728|ref|YP_002535296.1|
Domain Number 1 Region: 199-395
Classification Level Classification E-value
Superfamily PheT/TilS domain 9.15e-67
Family B3/B4 domain of PheRS, PheT 0.00000693
Further Details:      
 
Domain Number 2 Region: 463-682
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.17e-48
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00018
Further Details:      
 
Domain Number 3 Region: 44-190
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.2e-36
Family Myf domain 0.0029
Further Details:      
 
Domain Number 4 Region: 689-787
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.4e-29
Family Anticodon-binding domain of PheRS 0.00058
Further Details:      
 
Domain Number 5 Region: 401-471
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000146
Family Domains B1 and B5 of PheRS-beta, PheT 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222100728|ref|YP_002535296.1|
Sequence length 788
Comment phenylalanyl-tRNA synthetase subunit beta [Thermotoga neapolitana DSM 4359]
Sequence
MRVPESWLREFIDLDWDIEEIAERLTFSGTSVEDILKPFNVSGKIVTARVVETFQHPKSD
KLLVCRVDAGEKLYTVVTADRTVKEEDYVILALEGATLNNGVKIAPREFSGIVSEGMLCS
LEELGLEEKSDRVYRFPEPVTPGVNVIEEFGLDERVLDLEITPNRPDCLSILGVARELSA
LSRRPLKKPSPRVSFVDEDVPFDVIVEDVEGCPRYTARIMKGVTVKDSPLWLKARLVASG
MRSLNNVVDATNYVMLELGHPVHAFDLARLGNARIVVKTASGGERVLLLDEKEYEMKGGE
VLITDGENILALGGIMGGMESGVSENTRDLVLEVAYFDPVRIRKTSKSLGISSESSYRFE
RGVDPNDADLVSLKLAEMIQKLAGGVVLRKFWDVYPKKIEPKRVFLRKERVKKILGIEVE
EPDRILERLEFQVKSVENGYEVVVPTFRPDVEREIDLIEEIGRINGYEKIEPRIISLPAV
NIGWNRKQILRKEISHFMKGMGFDEIVSFSFVNSEKVKKWPVVRKEPIFLTNPISSDMDV
MRYTLFHSMIQVLSENFKRQNRNLKLFEIGKIYYRENGEYREVETLSAVACGLENPDDYT
DKRKVSFYTMKGVLDELFQRYGVRAEYREAELTGFFPTRTARIFSEGKELGFLGMVDPKL
LDEYDVKEETYFFEIDLESLAELVSERPVYKPTPKFPAVRRDVSFLLPRGFKSLEILDLF
RKMGESLVEEVGVFDVYEGKGVPEGMVSVTFYVIFRHPERTLTDEEVNQIFERMVQRVEE
KFGVKRRF
Download sequence
Identical sequences B9KAE7
gi|222100728|ref|YP_002535296.1| WP_015920168.1.34263 WP_015920168.1.6313 309803.CTN_1754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]