SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239825650|ref|YP_002948274.1| from Geobacillus sp. WCH70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239825650|ref|YP_002948274.1|
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily Hsp33 domain 3.92e-81
Family Hsp33 domain 0.0000000111
Further Details:      
 
Domain Number 2 Region: 232-288
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 7.59e-21
Family HSP33 redox switch-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|239825650|ref|YP_002948274.1|
Sequence length 295
Comment Hsp33-like chaperonin [Geobacillus sp. WCH70]
Sequence
MSDYLVKALAYDGQVRAYAARTTDTVSEAQRRHQTWPTASAALGRAITAGVMMGAMLKGD
DKLTIKIDGGGPIGTILVDSNAKGEVRGYVTNPHVHFDLNEHGKLDVAKAVGKNGMLTVV
KDLGLRDFFTGQVPIISGELGEDFTYYFASSEQVPSSVGVGVLVNPDNTILAAGGFIIQL
MPGTEEKTIEQIEQRLQTIPPVSKMVESGLTPEEILEELLGKGNVKVLETLPVSFVCRCS
RERIADAIISLGPQEIQDIMEKEGYAEASCHFCNETYHFTKEELEQLKQLAEAKN
Download sequence
Identical sequences A0A150N6P9 A0A226QLR3 A0A2A6AJ82 C5D392
471223.GWCH70_0066 WP_012748843.1.25537 WP_012748843.1.33554 WP_012748843.1.48526 WP_012748843.1.59651 WP_012748843.1.67826 gi|239825650|ref|YP_002948274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]