SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239825888|ref|YP_002948512.1| from Geobacillus sp. WCH70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239825888|ref|YP_002948512.1|
Domain Number 1 Region: 8-125
Classification Level Classification E-value
Superfamily AF1862-like 3.4e-34
Family Cas Cmr5-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|239825888|ref|YP_002948512.1|
Sequence length 127
Comment Cmr5 family CRISPR-associated protein [Geobacillus sp. WCH70]
Sequence
MREKVQRVGIENGRASFAFQEVKKAKEKDSVNFESYRSYVKKMPSLIQVNGLGQALAFCY
QKRKEYEEIYRSIHAWLKQRFSSFFQDDEKELVEVVINLPSADYRAVTMEVLALLNWMCK
FAEGMAK
Download sequence
Identical sequences C5D520
gi|239825888|ref|YP_002948512.1| 471223.GWCH70_0319 WP_012749063.1.59651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]