SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239825972|ref|YP_002948596.1| from Geobacillus sp. WCH70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239825972|ref|YP_002948596.1|
Domain Number 1 Region: 135-292
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.8e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000404
Further Details:      
 
Domain Number 2 Region: 392-526
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.81e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00019
Further Details:      
 
Domain Number 3 Region: 12-134
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.03e-31
Family Duplicated SiR/NiR-like domains 1 and 3 0.00044
Further Details:      
 
Domain Number 4 Region: 270-401
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.85e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|239825972|ref|YP_002948596.1|
Sequence length 541
Comment ferredoxin--nitrite reductase [Geobacillus sp. WCH70]
Sequence
MAYEKVWADNPKLNKMELKKLKKDGLKIFEDIPYYAKHGFSSIPQEEWDYFKWAGLYLQR
PKEDGYFMMRVCVPSGILSNEQLETLAGIARDYGRGLFDITTRQSVQFHWLRIEQIPDIF
DRLKRVGLSTAGACGDITRNIVGNPLAGIDPDELFDTREIVREVYEFFQHNEDFSNLPRK
YKISISANVYNTVNAEIHCLSFTPAKKVIDGKEVLGFHVKVGGGLSSAPYLAQTLDVFVT
PDRVKDVAVAVTTIFRDYGYREKRHRARLKFLVADWGVDKFKEKLIELTGPLPSKGEDVQ
KGWNPGYFYGVHRQKQEGLNFIGFNVPVGRLSADEVFEIARIARQYGNGEVRTCNSQNLI
IPNIPDKYVDAVLQEKVFERISIRPNTFTGYSVSCTGTEFCNLALVETKERMRRVAEYLD
QHLELDVPVRIHMVGCPNSCGQRQIGDIGLQGIKTKTKDRGMIEAFEIYVGGTLYNGGKY
NQKLKGKVDAERISEVLLQLLTYFKETKLPGETFLAYLDRVGIEALQTELDSILAQVSTV
A
Download sequence
Identical sequences A0A150MAX9 A0A2A6AK94 C5D5A4
gi|239825972|ref|YP_002948596.1| WP_012749143.1.25537 WP_012749143.1.59651 471223.GWCH70_0410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]