SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239826516|ref|YP_002949140.1| from Geobacillus sp. WCH70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239826516|ref|YP_002949140.1|
Domain Number 1 Region: 191-586
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.29e-98
Family beta-Lactamase/D-ala carboxypeptidase 0.00000418
Further Details:      
 
Domain Number 2 Region: 57-240
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.31e-46
Family Penicillin binding protein dimerisation domain 0.0000683
Further Details:      
 
Domain Number 3 Region: 657-711
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000000275
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0053
Further Details:      
 
Domain Number 4 Region: 599-654
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000106
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|239826516|ref|YP_002949140.1|
Sequence length 737
Comment peptidoglycan glycosyltransferase [Geobacillus sp. WCH70]
Sequence
MERKKHSNTHKGAAILFFLFSLLFFVLLARFIQLQVTGVADGQVLAAKAEEKYKQKRTIE
AKRGTIFDRNGEVLAQDVPSYTVIAVLDPKMTTDPDHPRHVVDPQKTAKKLAPLLKMDVD
EVKRILTKDAKQVEFGANGRNISYELKEKIEALNLPGIGFIRDTKRFYPNGNFASYVIGY
VQKNNKKNETVGKMGIEKSLDKHLREKDGYVSFAGDISGFRLPNTKETVVPPDNGANVYL
TIDQKIQTFLEDAMNDVEKQYKPKKIIAIVADPKTGKILAMGTRPSFDPNKRNIQNYFND
AISYPYEPGSTMKIFTLAAAINEGVYNGNEQYRSGYYKVGPNIIRDHNKVGWGTITFNEG
VQRSSNVAFSILVKEKLGEDRFLQYLHRFRFDKKTGIDLPGEAVGQIHYKYPIERITTGF
GQGTSVTPIQQIQAATAIANGGKMMKPYVVDRIVDPDTGKVIARNKPEVVEQPITKETAK
QVLDILETVVTSEKGTGRPYQIEGYRVAGKTGTAQIPSPRGGYLTGYENYIFSFLGMAPK
EDPRLIMYVAVQQPKLSYTETGAAPVSHIFTSVMKNSLQYLHIQPSSNKKASKEKSKGIE
IGSYAGRSTEEVVKELKEKGLVPIVIGNGRQIEEHVPLSGDKVIAGERVVLKTDGKAVMP
DVRGWSLRDVMKVAELLELRPSTKGNGYVVSQNIRPGALVKKGDYLIVELEEPRKWNERM
EQEQKEASDRKSDGPVD
Download sequence
Identical sequences A0A150MZ22 A0A2A6AMH3 C5D8L7
471223.GWCH70_1014 gi|239826516|ref|YP_002949140.1| WP_015863350.1.25537 WP_015863350.1.59651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]