SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239826569|ref|YP_002949193.1| from Geobacillus sp. WCH70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239826569|ref|YP_002949193.1|
Domain Number 1 Region: 7-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-85
Family Protein kinases, catalytic subunit 0.00000094
Further Details:      
 
Weak hits

Sequence:  gi|239826569|ref|YP_002949193.1|
Domain Number - Region: 362-423
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.021
Further Details:      
 
Domain Number - Region: 499-560
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00245
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|239826569|ref|YP_002949193.1|
Sequence length 653
Comment serine/threonine protein kinase with PASTA sensor(s) [Geobacillus sp. WCH70]
Sequence
MLIGKRLNDRYKIISLIGGGGMANVYLARDIILDRDVAVKVLRFDFANDEQFIKRFHREA
QAATSLNHENIVTIYDVGEDEGIYYIVMEYVRGYTLKQYIHQHAPLPVPKALHIMEQLTS
AIAHAHENGVIHRDIKPQNILIDENGDVKVTDFGIAVARSSTTITQTNSVLGSVHYLSPE
QARGGIATEKSDIYSLGIVMFELVTGRLPFSGESAVSIVLKHLQAETPSPKAWNPSIPQS
VENIILKATAKDPFYRYRSAREMNEDISTALDPERVNEQKFMIPADDEEPTKAIPVIRES
LVSAGLEQQTIVYEEKKEEEKKETKPKKKRKWIVWLTALFLFLAAAGVSAVTWIPDLIFP
KEVTMPNVVNEDYDEAVEKLSSLGLEIKDTIDVEDDEIAEGKVVRTKPEAGMMVKEGSAV
IIYKSIGKKKVEFGDFIGEDIETAEAQLKNENFMNVTRNERYSDKPPGTIIDQFPYAGDK
VIPEETKVIFTVSLGPEKIMLKDLTGYTEKSVRDYVDDQQLYLKVKYEYSDKVPEGLVIS
QTPTANEKVDKGDTITVIISRGKETLPVKTVIKDIEIPYEPEEEGQVMEAQLYIQDAKHN
MTTPYKTYRLTAPVTETVEFEIPYKETAYYRVIVNNVVKDEGTIPYPNNVTKE
Download sequence
Identical sequences A0A150MYV6 A0A2A6ALI4 C5D8S0
gi|239826569|ref|YP_002949193.1| 471223.GWCH70_1067 WP_015863401.1.25537 WP_015863401.1.33554 WP_015863401.1.59651 WP_015863401.1.67826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]