SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239827968|ref|YP_002950592.1| from Geobacillus sp. WCH70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239827968|ref|YP_002950592.1|
Domain Number 1 Region: 292-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.69e-48
Family ABC transporter ATPase domain-like 0.0000502
Further Details:      
 
Domain Number 2 Region: 17-287
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.7e-32
Family DNA repair protein MutS, domain III 0.0067
Further Details:      
 
Domain Number 3 Region: 708-783
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000000628
Family Smr domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|239827968|ref|YP_002950592.1|
Sequence length 784
Comment recombination and DNA strand exchange inhibitor protein [Geobacillus sp. WCH70]
Sequence
MHTRVLHVLEFDKVKEQLLEHVSSSLGKEKVEKLFPSSHFAEVTNWQEETDEAVAALRLR
GHVPLGGIFDIRASLKRAKIGGTLSPHELLDIASTISASRQLKQFIESLHEEKEEFPHLA
GYAEKLAALPEVQQAIERCIDDHGEVMDHASERLRSIRQQLRTTEARVREKLENIIRSQS
AQKMLSDAIITIRNDRYVIPVKQEYRGVYGGIVHDQSASGATLFIEPQAVVELNNQLQEA
RVKEKREIERILTELTSIVAEHAEALLENVDILAQLDFIFAKAKYANKLKATKPVMNDRG
YIRLLQARHPLIDQDVVVPNDIELGKDYTTIVITGPNTGGKTVTLKTIGLLTLMAQAGLF
IPALDGSELAVFRSVYADIGDEQSIEQSLSTFSSHMVNIVDILRNVDHESLVLFDELGAG
TDPQEGAALAIAILDEVHGRGARTVATTHYPELKAYGYNRDGVINASVEFDTETLRPTYK
LLIGIPGRSNAFEISKRLGLDERIIERAKSHISAESNKVENMIASLEQSKKRAEEEEKKA
KEARMEAEKLRSDWEQKWEELHEKRDEIIEEAKRKAADIVRASQQEAERIIRELRRMQKE
KQAEIKEHELIEAKKRLEEAIPTLEKKKKERKKQTQHAFQPGDEVKVTSLNQKGYLVEKV
SDDEWQVQLGILKMKINERDLEYIGSAPKTETKPLATVKGKDYHVGLELDLRGERYEDAI
VRLEKYIDDALLAGYPRVSIIHGKGTGALRKGVQEFLKKHRSVKNFHFGEANEGGTGVTI
VELK
Download sequence
Identical sequences A0A150N293 A0A226QJT9 A0A2A6AQ22 C5D5Q8
gi|239827968|ref|YP_002950592.1| 471223.GWCH70_2632 WP_015864737.1.25537 WP_015864737.1.33554 WP_015864737.1.48526 WP_015864737.1.59651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]