SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239826517|ref|YP_002949141.1| from Geobacillus sp. WCH70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239826517|ref|YP_002949141.1|
Domain Number 1 Region: 170-568
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.54e-103
Family beta-Lactamase/D-ala carboxypeptidase 0.0000259
Further Details:      
 
Domain Number 2 Region: 51-219
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.12e-48
Family Penicillin binding protein dimerisation domain 0.001
Further Details:      
 
Domain Number 3 Region: 583-635
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|239826517|ref|YP_002949141.1|
Sequence length 646
Comment stage V sporulation protein D [Geobacillus sp. WCH70]
Sequence
MRVSHVTVRKRLMIVFLVGVFIFAIIDIRLGYVQFILGDMLTERAKDSWSRNIPFEPKRG
EILDRNGVPLATNMSAPTVYVIPRQIENPAETAEKLAKVLNMPVEKAYKHITKKTSIERI
PEGRKISNEKAKEIRALGLKGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLTGLELYYD
KELSGQRGSVQFYSDAKGKRMPNMADDYTPPTDGLNLVLTIDSRIQTIVERELDIAEAKY
NPDGIIAIAMNPNTGEILAMASRPTFDPANYRTVPPEIYNRNLPIWSTYEPGSTFKIITL
AAALEEKKVNLLKDHFYDPGYVKVAGATLRCWKKGGHGSQTFLEVVQNSCNPGFVELGER
LGKERLFEYIKKFGFGEKTGIDLQGEGTGILFDLKRVGPVEQATTAFGQGVSVTPIQQVA
AVSAAVNGGILYTPYIAKQWVDPETGKVVSRNTLKAKRRVISEETSKQIRYALESVVAQG
TGKGAYVEGYRVGGKTGTAQKAKGGRYLKDNHIVSFIGFAPADDPQLVVYVAVDNPKGTV
QFGGVVSAPIVGKIMEDSLRTLGVKPRKGQIEKERAWNDPKMVEVPNLIGLSKKDLQEQL
FNLKLDVSGEGDVVIEQAPEPGVKVKEGSTIRIYLASKMSSKKEVR
Download sequence
Identical sequences A0A150MZ02 C5D8L8
471223.GWCH70_1015 WP_015863351.1.25537 WP_015863351.1.59651 gi|239826517|ref|YP_002949141.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]