SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256819419|ref|YP_003140698.1| from Capnocytophaga ochracea DSM 7271

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256819419|ref|YP_003140698.1|
Domain Number 1 Region: 9-217
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.65e-55
Family PP-loop ATPase 0.0000665
Further Details:      
 
Domain Number 2 Region: 341-424
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.93e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256819419|ref|YP_003140698.1|
Sequence length 431
Comment tRNA(Ile)-lysidine synthetase [Capnocytophaga ochracea DSM 7271]
Sequence
MNVEIKKLKEKKILVAISGGIDSVVLTHLLYTHGIELLLAHCNFQLRGRESDDDEAFVRT
FAAELSVPLEVKRFDTHQYASSHQLNTQLAARELRYQWFDELASTHFCDAIATAHHANDN
LETFFINLSRGSGLEGLLGIPEEKDTIIRPLLQFSRQQIYEYAQAKRLKWREDSSNETNK
YVRNVIRHDIIPKLALVHPNYLENFNQTQEYLHQSARFIDFYIGKLKETCFEGHNPIQID
IEKLQAVPELDFVLHKLFYPYGFGNVKDLKNLLLNAEAGKQVLSPTHILIKDNTCLWLKP
NEAKRSLSLLISEDMAEVYDPVHLRFEFIEGKVKVKNPIPTEIYVDADKLQYPLMLRYKK
EGDVFYPFGMNSEKKLSKFFTDEKYTQIEREEQVLLCSGEDIVWVVGKRLDDRFKITKDT
KRAVKISKLEN
Download sequence
Identical sequences C7M7I0
WP_015781862.1.37490 521097.Coch_0579 gi|256819419|ref|YP_003140698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]