SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256819977|ref|YP_003141256.1| from Capnocytophaga ochracea DSM 7271

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256819977|ref|YP_003141256.1|
Domain Number 1 Region: 216-410
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.57e-64
Family B3/B4 domain of PheRS, PheT 0.0000117
Further Details:      
 
Domain Number 2 Region: 42-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.74e-43
Family Myf domain 0.0041
Further Details:      
 
Domain Number 3 Region: 481-702
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.74e-35
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.001
Further Details:      
 
Domain Number 4 Region: 711-809
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 7.45e-31
Family Anticodon-binding domain of PheRS 0.0012
Further Details:      
 
Domain Number 5 Region: 418-488
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000375
Family Domains B1 and B5 of PheRS-beta, PheT 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256819977|ref|YP_003141256.1|
Sequence length 810
Comment phenylalanyl-tRNA synthetase subunit beta [Capnocytophaga ochracea DSM 7271]
Sequence
MKISYNWLKQYLKLEMPAEDTAVILTDLGLEVEGIEHFESVKGGLKGVVVGHVLECEKHP
NADKLKITKVDVGGEAPLQIVCGAPNVAQGQKVLVATIGTVLYDKAGKPFEIKKGKIRGE
ESYGMICAEDELGLGESHDGIMVLDSKWEVGTPASKVFEVETDEVFEIGLTPNRADAMSH
YGVARDLRAGLMQKGISLELITPSITKFHVDNRSLKMDIEVQNKKLVPRYTGVTISNVRV
DESPEWLQNKLKAIGITPKNNVVDATNYVLHGMGQPIHAFDADHIIGRKVIVKNADEGTK
FKTLDGVERTLNAEDIMICDAEKPLCIAGVLGGENSGITHFTRNVFLESAYFDAVSVRKT
AKRHGINTDASYRFERGINIEDCKYALMYAAVLIENIAGGVISSDVIDFYPKKQEDFQVF
LTFEKIDKLIGQKISRDTIKAILHSLDIKVNSFTERGLGLSVPSYRVDVQREADVIEEIL
RIYGYNNVIFSEKLNATMAHSNKYDDHNIQNVVADQLVAKGFFEIMTNSLVSEKEITTYA
ENPEQAVKLLNPLSSDLGYMRKNLVFSGLEVIAYNNNRKRSDLKLFEFGKNYHYIDGNYT
ENKHLVLYLTGNTQPEYWGAPAQKTSFFELKGVVESLFERLGLKEITILPLEANDTLSSE
GFRWQIGETLLGTIGVVKSKVLKDFDIKQEVLVADLHWEVILEQVQDHKVVYKEISKYPE
VRRDLALLLDEKVTFADLYEKAYATEKNLLKHVNLFDVYQGDKLPEGKKSYALSFVLQDN
NKTLTDKQIDKTMQHLQDAFEKQFGAALRE
Download sequence
Identical sequences C7M4E0
gi|256819977|ref|YP_003141256.1| 521097.Coch_1142 WP_015782335.1.37490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]