SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790742|ref|YP_003181348.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790742|ref|YP_003181348.1|
Domain Number 1 Region: 66-129
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000000000223
Family Di-heme elbow motif 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257790742|ref|YP_003181348.1|
Sequence length 148
Comment flavocytochrome c [Eggerthella lenta DSM 2243]
Sequence
MPDVKRKNLLMAVCTVLATVALAATLGGCAPSQPSGDAGNGGADAASYPVGSLKAVHVAG
QLDDADEYPNKLCLSCHDRTTINAANEDFGGIEGFNPHKAHLEAGDCTSCHSVDGTSTLS
CNECHDAPLPEGWQSAERGSGPLHSLTK
Download sequence
Identical sequences A0A096KYN2 C8WP70
WP_009304875.1.14381 WP_009304875.1.87427 WP_009304875.1.89587 WP_009304875.1.95410 gi|257790742|ref|YP_003181348.1| 479437.Elen_0987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]