SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257791282|ref|YP_003181888.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257791282|ref|YP_003181888.1|
Domain Number 1 Region: 14-220
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.41e-48
Family N-type ATP pyrophosphatases 0.0000037
Further Details:      
 
Domain Number 2 Region: 207-327
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.44e-39
Family GMP synthetase C-terminal dimerisation domain 0.000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257791282|ref|YP_003181888.1|
Sequence length 327
Comment GMP synthase [Eggerthella lenta DSM 2243]
Sequence
MDPNKRPEDMERITTPELANAFIDEQMDAIRAQIGDKKVLLALSGGVDSSVVAALLIKAI
GKQLICVHVNHGLMRKGESEQVVDVFQNQLDANLVYVDATDRFLELLDDVAEPEAKRKII
GAEFIRVFEEEARKVGDEVSFLAQGTIYPDILESDGVKAHHNVGGLPDDLQFELCEPVKL
LYKDEVRVIGRELGLPEGMVERQPFPGPGLGVRCLGAITRDRLEALREADAILRDEFAAA
GLEGKVWQYFVSVPDFRATGVRDGVRAFEWPAIIRAVNTVDAMTAEVPELDWALLKKITE
RILAEVPGICRVVYDLTPKPIGTIEWE
Download sequence
Identical sequences A0A096KNG9 C8WHA8
WP_015760623.1.14381 WP_015760623.1.87427 WP_015760623.1.89587 gi|257791282|ref|YP_003181888.1| 479437.Elen_1531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]