SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257791379|ref|YP_003181985.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257791379|ref|YP_003181985.1|
Domain Number 1 Region: 297-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-47
Family Ribonuclease PH domain 1-like 0.00000685
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.23e-40
Family Ribonuclease PH domain 1-like 0.0000351
Further Details:      
 
Domain Number 3 Region: 450-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.71e-27
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 143-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-23
Family Ribonuclease PH domain 2-like 0.0025
Further Details:      
 
Domain Number 5 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.02e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 6 Region: 620-690
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.13e-19
Family Cold shock DNA-binding domain-like 0.00068
Further Details:      
 
Domain Number 7 Region: 248-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000222
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257791379|ref|YP_003181985.1|
Sequence length 741
Comment Polyribonucleotide nucleotidyltransferase [Eggerthella lenta DSM 2243]
Sequence
MKKIVESFELYGKQYRLETGELAKQATGSVVVTQGDTTVLVTAVISKEEKDYDFFPLTVD
FIEKMYAVGRIPGGYLKREARPSDKGTLTARMVDRPIRPGFADGFKREVHVVCTTLVVDS
INPPDTICVMGASAALMLGAAPFDGPAACVRIGRDVETGEFIVNPTFEESENSDLELTIA
GTADYISMVEAGADEISEEDMLAAMTFGQEAIAAFCEAQQRFLDRANIEPVEWPVHVADP
AIAERVAPFMAEMSAALRDADKLSRMGKVEELKARIKEEQFSDEERAAWKGDIAAELKKL
EKKAMRAMVIETGERADGRRPEDIRPLYIVPGYLPRVHGSGLFQRGQTQALSVCTLGMLN
EWQRLDTIDPAEGKRYMHQYNFPPYCTGETGRMGAPKRREIGHGALAERALIPVLPSEDE
FPYAIRVVSEVLESNGSSSMASTCGSTLALMDAGVPIKAPVSGIAMGLIKEGDDVVILSD
IQGIEDFLGDMDFKVCGTAKGITALQMDNKARGLSVDILARALKQASEGRAYILDAMLET
IAAPREELSEFAPRIETIHIPVDKIRDVIGSGGKVVRGIQEETGASINIEEDGTIHIAAI
EGPAGDAAKAMILGIVKEPEVGETFDGEVVGIKDFGAFVKLTPGKDGLLHISRVANGRVG
KVEDVLNLGDIIKVEVLEVDPKTGKISLDRLDKPDAPESSASNGERRERGDRNGGRDNRP
GRSGREGNGGGNRTPRRRHDA
Download sequence
Identical sequences A0A096KM66 C8WHK5
479437.Elen_1628 gi|257791379|ref|YP_003181985.1| WP_015760679.1.14381 WP_015760679.1.87427 WP_015760679.1.89587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]