SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257791437|ref|YP_003182043.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257791437|ref|YP_003182043.1|
Domain Number 1 Region: 105-204
Classification Level Classification E-value
Superfamily DsrEFH-like 0.0000000000000214
Family DsrEF-like 0.044
Further Details:      
 
Domain Number 2 Region: 1-70
Classification Level Classification E-value
Superfamily SirA-like 0.0000000000000275
Family SirA-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257791437|ref|YP_003182043.1|
Sequence length 204
Comment SirA family protein [Eggerthella lenta DSM 2243]
Sequence
MEQIDARGQACPLPVVRAKKALSAMGEGVLEVLVDNETAVHNLEALAKTLKVEAVGEKRG
EDAFAVTFSKGAAASDGQAGSAASCPAVDPAPTGGRVAVIPSEFMGSGDDELGAVLMKGF
VFALTQLDELPETVLMYNGGVKLACTGSSSLDDLRTLAEAGVEIMSCGTCLNHYGLAEQL
EVGEATNMYVIVEKQASARGIIRP
Download sequence
Identical sequences C8WHR3 T4BZG6
WP_015760717.1.14381 gi|257791437|ref|YP_003182043.1| 479437.Elen_1688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]