SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257791442|ref|YP_003182048.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257791442|ref|YP_003182048.1|
Domain Number 1 Region: 9-200
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.75e-41
Family G proteins 0.00011
Further Details:      
 
Domain Number 2 Region: 183-269
Classification Level Classification E-value
Superfamily Translation proteins 3.93e-23
Family Elongation factors 0.0005
Further Details:      
 
Domain Number 3 Region: 274-368
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 4.73e-16
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0043
Further Details:      
 
Domain Number 4 Region: 587-639
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000395
Family C-terminal fragment of elongation factor SelB 0.0036
Further Details:      
 
Domain Number 5 Region: 449-514
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000245
Family C-terminal fragment of elongation factor SelB 0.01
Further Details:      
 
Domain Number 6 Region: 524-582
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000129
Family C-terminal fragment of elongation factor SelB 0.067
Further Details:      
 
Weak hits

Sequence:  gi|257791442|ref|YP_003182048.1|
Domain Number - Region: 397-436
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0235
Family LexA repressor, N-terminal DNA-binding domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257791442|ref|YP_003182048.1|
Sequence length 643
Comment selenocysteine-specific translation elongation factor [Eggerthella lenta DSM 2243]
Sequence
MSGRTQTDLVLGTAGHIDHGKSSLVLALTGTDPDRLAEEKQRGITIELGFARLALPDGTV
LGVVDVPGHERFVRQMIAGSTGIDLALLCIAADDGIMPQTEEHLAVLELLGIRTCVVALT
KTDLVDEEWALFMADEVRGRLAGTPFADADIVPVSSRTGAGLPELQEALTRAARTTRRAK
AGSRLRLPVDRVFSIKGAGTVVTGTLWSGSARMGDEVEVLPSGLRTRVRSVQVHGEPVDR
ADAGHRVALNLNAVSTDEVRPGDFLAAPGAASATDRFDAHLAFLGVPGKGKPLVSGARVH
VAHGTREVTGRVLLMDGRPSLGVGERAYAQIRLDEPLPVAWRDRFVVRSYSPVHVVGGGE
VLRARPRRTTTLAPGALELLDALREGDEAAVAHAAFALTAAPVTAAELATLSGLEEDAAA
RELEALAAHGAAVRLGGERALRYAAPSVLQKQRAAIENALLKFHAENPAATGIAKDALRR
RCLPRADAGCFDALLDDAVARGAAVTDGGEVSHPKAGAGARKLEEQAAEQLRETLAAAAG
APPSTGELIASSGLDSSLVHRALGSLEKQGLVRRIGADFYFDVSALAAFEQAVRARLVDG
PATAAELKDAMGTSRKYAIPLLEYFDSQAVTRREGDTRVPGGR
Download sequence
Identical sequences C8WHR8
gi|257791442|ref|YP_003182048.1| 479437.Elen_1693 WP_015760720.1.14381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]