SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257791760|ref|YP_003182366.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257791760|ref|YP_003182366.1|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily L21p-like 2.62e-31
Family Ribosomal protein L21p 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257791760|ref|YP_003182366.1|
Sequence length 138
Comment 50S ribosomal protein L21 [Eggerthella lenta DSM 2243]
Sequence
MYAIVKTGGKQYKVAPGDKLNIEKLDAAVGDKVELEAICVVDGAKVEADPAKAAATKVTA
IILEQFKGEKQLVFKFKKRKNYKKLRGHRQQLTRVQIESVGSAKAEKPAVKKAAKKDDAE
KKPAPAKAADKPASEDAE
Download sequence
Identical sequences A0A096KRQ9 C8WIT5 F0HPC7 T4AZZ4
479437.Elen_2013 gi|257791760|ref|YP_003182366.1| WP_009304119.1.14381 WP_009304119.1.74853 WP_009304119.1.87427 WP_009304119.1.89587 WP_009304119.1.95410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]